Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CDKN2C, His-tagged

Cat.No. : CDKN2C-30048TH
Product Overview : Recombinant full length Human p18 INK4c (amino acids 1-168) fused to His tag at N-terminus; 192aa, 20.7kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.
Protein length : 168 amino acids
Conjugation : HIS
Molecular Weight : 20.700kDa inclusive of tags
Source : E. coli
Tissue specificity : Highest levels found in skeletal muscle. Also found in pancreas and heart.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 1.17% Sodium chloride
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAEPWGNELASAAARGDLEQ LTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIED NEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTA CDLARLYGRNEVVSLMQANGAGGATNLQ
Sequence Similarities : Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.Contains 4 ANK repeats.
Gene Name : CDKN2C cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) [ Homo sapiens ]
Official Symbol : CDKN2C
Synonyms : CDKN2C; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); cyclin-dependent kinase 4 inhibitor C; INK4C; p18;
Gene ID : 1031
mRNA Refseq : NM_001262
Protein Refseq : NP_001253
MIM : 603369
Uniprot ID : P42773
Chromosome Location : 1p32.3
Pathway : Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Cyclin D associated events in G1, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem;
Function : cyclin-dependent protein kinase inhibitor activity; protein kinase binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends