Recombinant Human CDKN2C protein, His-tagged
Cat.No. : | CDKN2C-2988H |
Product Overview : | Recombinant Human CDKN2C protein(1-75 aa ), fused to His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-75 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIH |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CDKN2C cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) [ Homo sapiens ] |
Official Symbol | CDKN2C |
Synonyms | CDKN2C; cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4); cyclin-dependent kinase 4 inhibitor C; INK4C; p18; p18-INK6; CDK6 inhibitor p18; cyclin-dependent inhibitor; cyclin-dependent kinase 6 inhibitor p18; p18-INK4C; |
Gene ID | 1031 |
mRNA Refseq | NM_001262 |
Protein Refseq | NP_001253 |
MIM | 603369 |
UniProt ID | P42773 |
◆ Recombinant Proteins | ||
CDKN2C-0571H | Recombinant Human CDKN2C Protein (M1-Q168), His/Strep tagged | +Inquiry |
CDKN2C-117H | Recombinant Human CDKN2C protein, T7-tagged | +Inquiry |
CDKN2C-3049H | Recombinant Human CDKN2C, T7-tagged | +Inquiry |
CDKN2C-2988H | Recombinant Human CDKN2C protein, His-tagged | +Inquiry |
CDKN2C-1294H | Recombinant Human CDKN2C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN2C-7612HCL | Recombinant Human CDKN2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN2C Products
Required fields are marked with *
My Review for All CDKN2C Products
Required fields are marked with *