Recombinant Human CEBPB, His-tagged

Cat.No. : CEBPB-27010TH
Product Overview : Recombinant fragment, corresponding to amino acids 125-345 of Human CEBP Beta with N terminal His tag; Predicted MWt 26 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 125-345 a.a.
Description : The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene.
Conjugation : HIS
Tissue specificity : Expressed at low levels in the lung, kidney and spleen.
Form : Lyophilised:Reconstitute with 85 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPP PPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAG FPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRR ERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
Sequence Similarities : Belongs to the bZIP family. C/EBP subfamily.Contains 1 bZIP domain.
Gene Name CEBPB CCAAT/enhancer binding protein (C/EBP), beta [ Homo sapiens ]
Official Symbol CEBPB
Synonyms CEBPB; CCAAT/enhancer binding protein (C/EBP), beta; TCF5; CCAAT/enhancer-binding protein beta; C/EBP beta; CRP2; IL6DBP; interleukin 6 dependent DNA binding protein; LAP; liver enriched transcriptional activator protein; NFIL6; nuclear factor of interleu
Gene ID 1051
mRNA Refseq NM_005194
Protein Refseq NP_005185
MIM 189965
Uniprot ID P17676
Chromosome Location 20q13.1
Pathway Adipogenesis, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem;
Function DNA binding; glucocorticoid receptor binding; protein binding; protein heterodimerization activity; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEBPB Products

Required fields are marked with *

My Review for All CEBPB Products

Required fields are marked with *

0
cart-icon
0
compare icon