Recombinant Human CEBPB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CEBPB-6222H
Product Overview : CEBPB MS Standard C13 and N15-labeled recombinant protein (NP_005185) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.
Molecular Mass : 35.9 kDa
AA Sequence : MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CEBPB CCAAT enhancer binding protein beta [ Homo sapiens (human) ]
Official Symbol CEBPB
Synonyms CEBPB; CCAAT/enhancer binding protein (C/EBP), beta; TCF5; CCAAT/enhancer-binding protein beta; C/EBP beta; CRP2; IL6DBP; interleukin 6 dependent DNA binding protein; LAP; liver enriched transcriptional activator protein; NFIL6; nuclear factor of interleukin 6; TCF-5; nuclear factor NF-IL6; transcription factor 5; interleukin 6-dependent DNA-binding protein; liver-enriched transcriptional activator protein; NF-IL6; C/EBP-beta; MGC32080;
Gene ID 1051
mRNA Refseq NM_005194
Protein Refseq NP_005185
MIM 189965
UniProt ID P17676

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEBPB Products

Required fields are marked with *

My Review for All CEBPB Products

Required fields are marked with *

0
cart-icon
0
compare icon