Recombinant Human CENPH, His-tagged
| Cat.No. : | CENPH-26924TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 136-247 of Human CENPH with an N terminal His tag; 133 amino acids with tag, Predicted MWt 15.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 112 amino acids |
| Description : | Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. |
| Conjugation : | HIS |
| Molecular Weight : | 15.500kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMLNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM |
| Sequence Similarities : | Belongs to the centromere protein H family. |
| Gene Name | CENPH centromere protein H [ Homo sapiens ] |
| Official Symbol | CENPH |
| Synonyms | CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1; |
| Gene ID | 64946 |
| mRNA Refseq | NM_022909 |
| Protein Refseq | NP_075060 |
| MIM | 605607 |
| Uniprot ID | Q9H3R5 |
| Chromosome Location | 5p15.2 |
| Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Replication, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; M Phase, organism-specific biosystem; |
| Function | kinetochore binding; protein binding; |
| ◆ Recombinant Proteins | ||
| CENPH-26924TH | Recombinant Human CENPH, His-tagged | +Inquiry |
| CENPH-6179C | Recombinant Chicken CENPH | +Inquiry |
| CENPH-325H | Recombinant Human CENPH Protein, His-tagged | +Inquiry |
| CENPH-11095H | Recombinant Human CENPH, His-tagged | +Inquiry |
| CENPH-1116H | Recombinant Human CENPH Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CENPH-7584HCL | Recombinant Human CENPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPH Products
Required fields are marked with *
My Review for All CENPH Products
Required fields are marked with *
