Recombinant Human CHMP2A, His-tagged

• Cat.No.: CHMP2A-27958TH
• Product Overview: Recombinant fragment, corresponding to amino acids 6-222 of Human CHMP2A with an N terminal His tag; Predicted MWt 25 kDa.

Specification

• Description: CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 110 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIA DIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANI QAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQ IQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEE SDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAE AAASALADADADLEERLKNLRRD

Gene Information

• Gene Name: CHMP2A charged multivesicular body protein 2A [ Homo sapiens ]
• Official Symbol: CHMP2A
• Synonyms: CHMP2A; charged multivesicular body protein 2A; chromatin modifying protein 2A; charged multivesicular body protein 2a; BC 2; CHMP2; putative breast adenocarcinoma marker (32kD); VPS2; VPS2 homolog A (S. cerevisiae); VPS2A
• Gene ID: 27243
• mRNA Refseq: NM_014453
• Protein Refseq: NP_055268
• MIM: 610893
• Uniprot ID: O43633
• Chromosome Location: 19q13.43
• Pathway: ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem
• Function: protein domain specific binding