Recombinant Human CHMP2A, His-tagged
Cat.No. : | CHMP2A-27958TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 6-222 of Human CHMP2A with an N terminal His tag; Predicted MWt 25 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 6-222 a.a. |
Description : | CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 110 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIA DIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANI QAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQ IQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEE SDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAE AAASALADADADLEERLKNLRRD |
Gene Name | CHMP2A charged multivesicular body protein 2A [ Homo sapiens ] |
Official Symbol | CHMP2A |
Synonyms | CHMP2A; charged multivesicular body protein 2A; chromatin modifying protein 2A; charged multivesicular body protein 2a; BC 2; CHMP2; putative breast adenocarcinoma marker (32kD); VPS2; VPS2 homolog A (S. cerevisiae); VPS2A; |
Gene ID | 27243 |
mRNA Refseq | NM_014453 |
Protein Refseq | NP_055268 |
MIM | 610893 |
Uniprot ID | O43633 |
Chromosome Location | 19q13.43 |
Pathway | ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
Function | protein domain specific binding; |
◆ Recombinant Proteins | ||
CHMP2A-675R | Recombinant Rhesus Macaque CHMP2A Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP2A-5210H | Recombinant Human CHMP2A protein, GST-tagged | +Inquiry |
Chmp2a-2146M | Recombinant Mouse Chmp2a Protein, Myc/DDK-tagged | +Inquiry |
CHMP2A-3205HF | Recombinant Full Length Human CHMP2A Protein, GST-tagged | +Inquiry |
CHMP2A-849R | Recombinant Rhesus monkey CHMP2A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP2A-7532HCL | Recombinant Human CHMP2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP2A Products
Required fields are marked with *
My Review for All CHMP2A Products
Required fields are marked with *