"CHMP2B" Related Products

Expand
Expand
Expand

Recombinant Human CHMP2B

Cat.No.: CHMP2B-27996TH
Product Overview: Recombinant full length protein corresponding to amino acids 1-213 of Human CHMP2B with a propreitary tag; predicted mwt: 49.06 kDa.
Description: This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration.
Protein length: 213 amino acids
Molecular Weight: 49.060kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed. Expressed in brain, heart, skeletal muscle, spleen, kidney, liver, small intestine, pancreas, lung, placenta and leukocytes. In brain, it is expressed in cerebellum, cerebral cortex, medulla, spinal chord, occipital lobe, frontal lobe, t
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
Sequence Similarities: Belongs to the SNF7 family.
Gene Name: CHMP2B charged multivesicular body protein 2B [ Homo sapiens ]
Official Symbol: CHMP2B
Synonyms: CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B;
Gene ID: 25978
mRNA Refseq: NM_001244644
Protein Refseq: NP_001231573
Uniprot ID: Q9UQN3
Chromosome Location: 3p12.1
Pathway: ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem;
Function: protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.