Recombinant Human CHMP2B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CHMP2B-5021H
Product Overview : CHMP2B MS Standard C13 and N15-labeled recombinant protein (NP_054762) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration.
Molecular Mass : 23.7 kDa
AA Sequence : MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CHMP2B charged multivesicular body protein 2B [ Homo sapiens (human) ]
Official Symbol CHMP2B
Synonyms CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B; VPS2 homolog B; vacuolar protein-sorting-associated protein 2-2; DMT1; VPS2-2; DKFZp564O123;
Gene ID 25978
mRNA Refseq NM_014043
Protein Refseq NP_054762
MIM 609512
UniProt ID Q9UQN3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHMP2B Products

Required fields are marked with *

My Review for All CHMP2B Products

Required fields are marked with *

0
cart-icon
0
compare icon