Recombinant Human CHMP2B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CHMP2B-5021H |
| Product Overview : | CHMP2B MS Standard C13 and N15-labeled recombinant protein (NP_054762) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. |
| Molecular Mass : | 23.7 kDa |
| AA Sequence : | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CHMP2B charged multivesicular body protein 2B [ Homo sapiens (human) ] |
| Official Symbol | CHMP2B |
| Synonyms | CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B; VPS2 homolog B; vacuolar protein-sorting-associated protein 2-2; DMT1; VPS2-2; DKFZp564O123; |
| Gene ID | 25978 |
| mRNA Refseq | NM_014043 |
| Protein Refseq | NP_054762 |
| MIM | 609512 |
| UniProt ID | Q9UQN3 |
| ◆ Recombinant Proteins | ||
| CHMP2B-79HF | Recombinant Full Length Human CHMP2B Protein | +Inquiry |
| CHMP2B-2491C | Recombinant Chicken CHMP2B | +Inquiry |
| CHMP2B-1651M | Recombinant Mouse CHMP2B Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHMP2B-4950H | Recombinant Human CHMP2B protein, GST-tagged | +Inquiry |
| CHMP2B-11185H | Recombinant Human CHMP2B, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHMP2B-110HKCL | Human CHMP2B Knockdown Cell Lysate | +Inquiry |
| CHMP2B-185HCL | Recombinant Human CHMP2B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP2B Products
Required fields are marked with *
My Review for All CHMP2B Products
Required fields are marked with *
