Recombinant Human CIRBP
Cat.No. : | CIRBP-27251TH |
Product Overview : | Recombinant full length Human CIRBP with N-terminal proprietary tag. Predicted MW 45.03kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 172 amino acids |
Description : | Cold-inducible RNA-binding protein is a protein that in humans is encoded by the CIRBP gene. |
Molecular Weight : | 45.030kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKD RETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD QAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD RGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSY RDSYDSYATHNE |
Sequence Similarities : | Contains 1 RRM (RNA recognition motif) domain. |
Gene Name | CIRBP cold inducible RNA binding protein [ Homo sapiens ] |
Official Symbol | CIRBP |
Synonyms | CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein; |
Gene ID | 1153 |
mRNA Refseq | NM_001280 |
Protein Refseq | NP_001271 |
MIM | 602649 |
Uniprot ID | Q14011 |
Chromosome Location | 19p13.3 |
Function | RNA binding; SSU rRNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
CIRBP-880R | Recombinant Rhesus monkey CIRBP Protein, His-tagged | +Inquiry |
CIRBP-122H | Recombinant Human CIRBP, His tagged | +Inquiry |
CIRBP-604H | Recombinant Human CIRBP Protein, His-tagged | +Inquiry |
CIRBP-3479M | Recombinant Mouse CIRBP Protein | +Inquiry |
CIRBP-4248H | Recombinant Human CIRBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIRBP-7491HCL | Recombinant Human CIRBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CIRBP Products
Required fields are marked with *
My Review for All CIRBP Products
Required fields are marked with *
0
Inquiry Basket