"CLDN4" Related Products

Expand

Recombinant Human CLDN4

Cat.No.: CLDN4-27272TH
Product Overview: Recombinant full length Human Claudin 4 with N terminal proprietary tag; Predicted MWt 48.73 kDa including the tag.
Description: This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.
Protein length: 209 amino acids
Molecular Weight: 48.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNI VTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAA RALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREM GASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAA RSAAASNYV
Sequence Similarities: Belongs to the claudin family.
Gene Name: CLDN4 claudin 4 [ Homo sapiens ]
Official Symbol: CLDN4
Synonyms: CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein;
Gene ID: 1364
mRNA Refseq: NM_001305
Protein Refseq: NP_001296
MIM: 602909
Uniprot ID: O14493
Chromosome Location: 7q11.23
Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function: identical protein binding; structural molecule activity; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.