Recombinant Human CLDN4
| Cat.No. : | CLDN4-27272TH |
| Product Overview : | Recombinant full length Human Claudin 4 with N terminal proprietary tag; Predicted MWt 48.73 kDa including the tag. |
| Availability | December 08, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 209 amino acids |
| Description : | This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. |
| Molecular Weight : | 48.730kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNI VTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAA RALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREM GASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAA RSAAASNYV |
| Sequence Similarities : | Belongs to the claudin family. |
| Gene Name | CLDN4 claudin 4 [ Homo sapiens ] |
| Official Symbol | CLDN4 |
| Synonyms | CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; |
| Gene ID | 1364 |
| mRNA Refseq | NM_001305 |
| Protein Refseq | NP_001296 |
| MIM | 602909 |
| Uniprot ID | O14493 |
| Chromosome Location | 7q11.23 |
| Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
| Function | identical protein binding; structural molecule activity; transmembrane signaling receptor activity; |
| ◆ Recombinant Proteins | ||
| RFL1476BF | Recombinant Full Length Bovine Claudin-4(Cldn4) Protein, His-Tagged | +Inquiry |
| CLDN4-27272TH | Recombinant Human CLDN4 | +Inquiry |
| RFL15864MF | Recombinant Full Length Mouse Claudin-4(Cldn4) Protein, His-Tagged | +Inquiry |
| Cldn4-901M | Recombinant Mouse Cldn4 Protein, MYC/DDK-tagged | +Inquiry |
| CLDN4-722R | Recombinant Rhesus Macaque CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN4 Products
Required fields are marked with *
My Review for All CLDN4 Products
Required fields are marked with *
