"CNN3" Related Products

Expand

Recombinant Human CNN3

Cat.No.: CNN3-26294TH
Product Overview: Recombinant full length Human Acidic Calponin with N terminal proprietary tag. Predicted MW 62.26 kDa.
Description: This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction.
Protein length: 329 amino acids
Molecular Weight: 62.260kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in both non-smooth muscle tissues as well as smooth muscle tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVT GMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNW PQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT TLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAG QSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFD QTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPV IHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDY QYSDQGIDY
Sequence Similarities: Belongs to the calponin family.Contains 3 calponin-like repeats.Contains 1 CH (calponin-homology) domain.
Gene Name: CNN3 calponin 3, acidic [ Homo sapiens ]
Official Symbol: CNN3
Synonyms: CNN3; calponin 3, acidic; calponin-3;
Gene ID: 1266
mRNA Refseq: NM_001839
Protein Refseq: NP_001830
MIM: 602374
Uniprot ID: Q15417
Chromosome Location: 1p22-p21
Function: actin binding; actin binding; calmodulin binding; tropomyosin binding; troponin C binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.