Recombinant Human CNN3
Cat.No. : | CNN3-26293TH |
Product Overview : | Recombinant fragment of Human Acidic Calponin with N terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in both non-smooth muscle tissues as well as smooth muscle tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY |
Sequence Similarities : | Belongs to the calponin family.Contains 3 calponin-like repeats.Contains 1 CH (calponin-homology) domain. |
Gene Name | CNN3 calponin 3, acidic [ Homo sapiens ] |
Official Symbol | CNN3 |
Synonyms | CNN3; calponin 3, acidic; calponin-3; |
Gene ID | 1266 |
mRNA Refseq | NM_001839 |
Protein Refseq | NP_001830 |
MIM | 602374 |
Uniprot ID | Q15417 |
Chromosome Location | 1p22-p21 |
Function | actin binding; actin binding; calmodulin binding; tropomyosin binding; troponin C binding; |
◆ Recombinant Proteins | ||
CNN3-1930HF | Recombinant Full Length Human CNN3 Protein, GST-tagged | +Inquiry |
CNN3-26294TH | Recombinant Human CNN3 | +Inquiry |
CNN3-937R | Recombinant Rhesus monkey CNN3 Protein, His-tagged | +Inquiry |
CNN3-416H | Recombinant Human CNN3 Protein (2-329 aa), His-tagged | +Inquiry |
CNN3-680HFL | Recombinant Full Length Human CNN3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN3-7404HCL | Recombinant Human CNN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN3 Products
Required fields are marked with *
My Review for All CNN3 Products
Required fields are marked with *