Recombinant Human CNN3
| Cat.No. : | CNN3-26293TH |
| Product Overview : | Recombinant fragment of Human Acidic Calponin with N terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Expressed in both non-smooth muscle tissues as well as smooth muscle tissues. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY |
| Sequence Similarities : | Belongs to the calponin family.Contains 3 calponin-like repeats.Contains 1 CH (calponin-homology) domain. |
| Gene Name | CNN3 calponin 3, acidic [ Homo sapiens ] |
| Official Symbol | CNN3 |
| Synonyms | CNN3; calponin 3, acidic; calponin-3; |
| Gene ID | 1266 |
| mRNA Refseq | NM_001839 |
| Protein Refseq | NP_001830 |
| MIM | 602374 |
| Uniprot ID | Q15417 |
| Chromosome Location | 1p22-p21 |
| Function | actin binding; actin binding; calmodulin binding; tropomyosin binding; troponin C binding; |
| ◆ Recombinant Proteins | ||
| CNN3-1569H | Recombinant Human CNN3 Protein, GST-tagged | +Inquiry |
| CNN3-1807M | Recombinant Mouse CNN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CNN3-680HFL | Recombinant Full Length Human CNN3 Protein, C-Flag-tagged | +Inquiry |
| CNN3-2421H | Recombinant Human CNN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CNN3-1149R | Recombinant Rat CNN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNN3-7404HCL | Recombinant Human CNN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN3 Products
Required fields are marked with *
My Review for All CNN3 Products
Required fields are marked with *
