Recombinant Full Length Human CNN3 Protein
| Cat.No. : | CNN3-100HF |
| Product Overview : | Recombinant full length Human Acidic Calponin with N terminal proprietary tag. Predicted MW 62.26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 329 amino acids |
| Description : | This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. |
| Form : | Liquid |
| Molecular Mass : | 62.260kDa inclusive of tags |
| AA Sequence : | MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVT GMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNW PQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT TLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAG QSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFD QTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPV IHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDY QYSDQGIDY |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | CNN3 calponin 3, acidic [ Homo sapiens ] |
| Official Symbol | CNN3 |
| Synonyms | CNN3; calponin 3, acidic; calponin-3 |
| Gene ID | 1266 |
| mRNA Refseq | NM_001839 |
| Protein Refseq | NP_001830 |
| MIM | 602374 |
| UniProt ID | Q15417 |
| ◆ Recombinant Proteins | ||
| Cnn3-2219M | Recombinant Mouse Cnn3 Protein, Myc/DDK-tagged | +Inquiry |
| CNN3-629H | Recombinant Human CNN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CNN3-680HFL | Recombinant Full Length Human CNN3 Protein, C-Flag-tagged | +Inquiry |
| CNN3-26294TH | Recombinant Human CNN3 | +Inquiry |
| CNN3-1930HF | Recombinant Full Length Human CNN3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNN3-7404HCL | Recombinant Human CNN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN3 Products
Required fields are marked with *
My Review for All CNN3 Products
Required fields are marked with *
