Recombinant Human COPS5, His-tagged

Cat.No. : COPS5-29878TH
Product Overview : Recombinant fragment, corresponding to amino acids 10-334 of Human JAB1 with N terminal His tag; 325 amino acids, 43kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 10-334 a.a.
Description : The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation ofcyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 104 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDH HYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDG ETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQV GRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF VAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEY QTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWN KYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLG RGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLM SQVIKDKLFNQINIS
Sequence Similarities : Belongs to the peptidase M67A family. CSN5 subfamily.Contains 1 MPN (JAB/Mov34) domain.
Gene Name COPS5 COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) [ Homo sapiens ]
Official Symbol COPS5
Synonyms COPS5; COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis); COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 5; COP9 signalosome complex subunit 5; CSN5; JAB1; MOV 34; SGN5;
Gene ID 10987
mRNA Refseq NM_006837
Protein Refseq NP_006828
MIM 604850
Uniprot ID Q92905
Chromosome Location 8q13
Pathway HIF-1-alpha transcription factor network, organism-specific biosystem; Hypoxic and oxygen homeostasis regulation of HIF-1-alpha, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem;
Function metal ion binding; metallopeptidase activity; peptidase activity; protein binding; transcription coactivator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COPS5 Products

Required fields are marked with *

My Review for All COPS5 Products

Required fields are marked with *

0
cart-icon