Recombinant Full Length Human COPS5 Protein, GST-tagged

Cat.No. : COPS5-1959HF
Product Overview : Human COPS5 full-length ORF ( AAH01187.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 334 amino acids
Description : The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. [provided by RefSeq, Jul 2008]
Molecular Mass : 62.48 kDa
AA Sequence : MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COPS5 COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) [ Homo sapiens ]
Official Symbol COPS5
Synonyms COPS5; COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis); COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 5; COP9 signalosome complex subunit 5; CSN5; JAB1; MOV 34; SGN5; 38 kDa Mov34 homolog; signalosome subunit 5; jun activation domain-binding protein 1; MOV-34; MGC3149
Gene ID 10987
mRNA Refseq NM_006837
Protein Refseq NP_006828
MIM 604850
UniProt ID Q92905

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COPS5 Products

Required fields are marked with *

My Review for All COPS5 Products

Required fields are marked with *

0
cart-icon