Recombinant Human COX4I1
| Cat.No. : | COX4I1-26361TH |
| Product Overview : | Recombinant full length, Human COX IV with proprietary tag, Predicted MW 44.33 kDa. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 169 amino acids |
| Description : | Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3 of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. |
| Molecular Weight : | 44.330kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK |
| Sequence Similarities : | Belongs to the cytochrome c oxidase IV family. |
| Gene Name | COX4I1 cytochrome c oxidase subunit IV isoform 1 [ Homo sapiens ] |
| Official Symbol | COX4I1 |
| Synonyms | COX4I1; cytochrome c oxidase subunit IV isoform 1; COX4, cytochrome c oxidase subunit IV; cytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX4 1; |
| Gene ID | 1327 |
| mRNA Refseq | NM_001861 |
| Protein Refseq | NP_001852 |
| MIM | 123864 |
| Uniprot ID | P13073 |
| Chromosome Location | 16q24.1 |
| Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Cytochrome c oxidase, organism-specific biosystem; |
| Function | cytochrome-c oxidase activity; |
| ◆ Recombinant Proteins | ||
| COX4I1-1782H | Recombinant Human COX4I1 Protein (Ala23-Lys169), N-His tagged | +Inquiry |
| COX4I1-2290C | Recombinant Chicken COX4I1 | +Inquiry |
| RFL22307BF | Recombinant Full Length Bovine Cytochrome C Oxidase Subunit 4 Isoform 1, Mitochondrial(Cox4I1) Protein, His-Tagged | +Inquiry |
| COX4I1-2003HF | Recombinant Full Length Human COX4I1 Protein, GST-tagged | +Inquiry |
| COX4I1-987R | Recombinant Rhesus monkey COX4I1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COX4I1-478HKCL | Human COX4I1 Knockdown Cell Lysate | +Inquiry |
| COX4I1-7334HCL | Recombinant Human COX4I1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX4I1 Products
Required fields are marked with *
My Review for All COX4I1 Products
Required fields are marked with *
