Recombinant Human COX4I1
Cat.No. : | COX4I1-26361TH |
Product Overview : | Recombinant full length, Human COX IV with proprietary tag, Predicted MW 44.33 kDa. |
Availability | October 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 169 amino acids |
Description : | Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3 of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. |
Molecular Weight : | 44.330kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK |
Sequence Similarities : | Belongs to the cytochrome c oxidase IV family. |
Gene Name | COX4I1 cytochrome c oxidase subunit IV isoform 1 [ Homo sapiens ] |
Official Symbol | COX4I1 |
Synonyms | COX4I1; cytochrome c oxidase subunit IV isoform 1; COX4, cytochrome c oxidase subunit IV; cytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX4 1; |
Gene ID | 1327 |
mRNA Refseq | NM_001861 |
Protein Refseq | NP_001852 |
MIM | 123864 |
Uniprot ID | P13073 |
Chromosome Location | 16q24.1 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Cytochrome c oxidase, organism-specific biosystem; |
Function | cytochrome-c oxidase activity; |
◆ Recombinant Proteins | ||
COX4I1-419H | Recombinant Human COX4I1 Protein (23-169 aa), His-SUMO-tagged | +Inquiry |
COX4I1-1207R | Recombinant Rat COX4I1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX4I1-831H | Recombinant Human COX4I1 Protein, His-tagged | +Inquiry |
COX4I1-12731Z | Recombinant Zebrafish COX4I1 | +Inquiry |
COX4I1-1782H | Recombinant Human COX4I1 Protein (Ala23-Lys169), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX4I1-7334HCL | Recombinant Human COX4I1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX4I1 Products
Required fields are marked with *
My Review for All COX4I1 Products
Required fields are marked with *