Recombinant Full Length Human COX4I1 Protein, GST-tagged
Cat.No. : | COX4I1-2003HF |
Product Overview : | Human COX4I1 full-length ORF ( AAH08704, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 169 amino acids |
Description : | Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. Pseudogenes related to this gene are located on chromosomes 13 and 14. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 44.33 kDa |
AA Sequence : | MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX4I1 cytochrome c oxidase subunit IV isoform 1 [ Homo sapiens ] |
Official Symbol | COX4I1 |
Synonyms | COX4I1; cytochrome c oxidase subunit IV isoform 1; COX4, cytochrome c oxidase subunit IV; cytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX4 1; COX IV-1; cytochrome c oxidase polypeptide IV; COX4; COXIV; COX4-1; FLJ23483; MGC72016 |
Gene ID | 1327 |
mRNA Refseq | NM_001861 |
Protein Refseq | NP_001852 |
MIM | 123864 |
UniProt ID | P13073 |
◆ Recombinant Proteins | ||
COX4I1-1742H | Recombinant Human COX4I1 Protein, GST-tagged | +Inquiry |
COX4I1-419H | Recombinant Human COX4I1 Protein (23-169 aa), His-SUMO-tagged | +Inquiry |
COX4I1-1782H | Recombinant Human COX4I1 Protein (Ala23-Lys169), N-His tagged | +Inquiry |
RFL22307BF | Recombinant Full Length Bovine Cytochrome C Oxidase Subunit 4 Isoform 1, Mitochondrial(Cox4I1) Protein, His-Tagged | +Inquiry |
COX4I1-26361TH | Recombinant Human COX4I1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX4I1-7334HCL | Recombinant Human COX4I1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX4I1 Products
Required fields are marked with *
My Review for All COX4I1 Products
Required fields are marked with *