"CPLX1" Related Products

Expand
Expand

Recombinant Human CPLX1, His-tagged

Cat.No.: CPLX1-27587TH
Product Overview: Recombinant full length Human CPLX1 with N terminal His tag; 154 amino acids with a predicted MWt 17.1 kDa including tag.
Description: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis.These proteins bind syntaxin, part of the SNAP receptor.The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release.
Protein length: 134 amino acids
Conjugation: HIS
Molecular Weight: 17.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Nervous system. In hippocampus and cerebellum, expressed mainly by inhibitory neurons. Overexpressed in substantia nigra from patients with Parkinson disease.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol
Storage: Please see Notes section
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEFVMKQALGGATKDMGKML GGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE AVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA IPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK
Sequence Similarities: Belongs to the complexin/synaphin family.
Gene Name: CPLX1 complexin 1 [ Homo sapiens ]
Official Symbol: CPLX1
Synonyms: CPLX1; complexin 1; complexin-1; CPX I;
Gene ID: 10815
mRNA Refseq: NM_006651
Protein Refseq: NP_006642
MIM: 605032
Uniprot ID: O14810
Chromosome Location: 4p16.3
Pathway: Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem; Glutamate Neurotransmitter Release Cycle, organism-specific biosystem; Neuronal System, organism-specific biosystem;
Function: neurotransmitter transporter activity; syntaxin-1 binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.