Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CPLX1, His-tagged

Cat.No. : CPLX1-27587TH
Product Overview : Recombinant full length Human CPLX1 with N terminal His tag; 154 amino acids with a predicted MWt 17.1 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
Description : Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis.These proteins bind syntaxin, part of the SNAP receptor.The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release.
Protein length : 134 amino acids
Conjugation : HIS
Molecular Weight : 17.100kDa inclusive of tags
Source : E. coli
Tissue specificity : Nervous system. In hippocampus and cerebellum, expressed mainly by inhibitory neurons. Overexpressed in substantia nigra from patients with Parkinson disease.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol
Storage : Please see Notes section
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMEFVMKQALGGATKDMGKML GGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE AVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA IPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK
Sequence Similarities : Belongs to the complexin/synaphin family.
Gene Name : CPLX1 complexin 1 [ Homo sapiens ]
Official Symbol : CPLX1
Synonyms : CPLX1; complexin 1; complexin-1; CPX I;
Gene ID : 10815
mRNA Refseq : NM_006651
Protein Refseq : NP_006642
MIM : 605032
Uniprot ID : O14810
Chromosome Location : 4p16.3
Pathway : Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem; Glutamate Neurotransmitter Release Cycle, organism-specific biosystem; Neuronal System, organism-specific biosystem;
Function : neurotransmitter transporter activity; syntaxin-1 binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends