Recombinant Human CSE1L
| Cat.No. : | CSE1L-27953TH |
| Product Overview : | Recombinant full length Human Cellular Apoptosis Susceptibility with N terminal proprietary tag, predicted mwt: 47.52 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. |
| Protein length : | 195 amino acids |
| Molecular Weight : | 47.520kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Highly expressed in proliferating cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQ NYPLLLLTLLEKSQDNVIKVCASVTFKNYIKRNWRIVEDE PNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRY RHEFKSNELWTEIKLVLDAFALPLTNLFKVWNASW |
| Sequence Similarities : | Belongs to the XPO2/CSE1 family.Contains 1 importin N-terminal domain. |
| Gene Name : | CSE1L CSE1 chromosome segregation 1-like (yeast) [ Homo sapiens ] |
| Official Symbol : | CSE1L |
| Synonyms : | CSE1L; CSE1 chromosome segregation 1-like (yeast); chromosome segregation 1 (yeast homolog) like; exportin-2; CAS; CSE1; XPO2; |
| Gene ID : | 1434 |
| mRNA Refseq : | NM_001316 |
| Protein Refseq : | NP_001307 |
| MIM : | 601342 |
| Uniprot ID : | P55060 |
| Chromosome Location : | 20q13 |
| Pathway : | Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem; |
| Function : | importin-alpha export receptor activity; protein binding; protein transporter activity; |
Products Types
| ◆ Recombinant Protein | ||
| CSE1L-2732H | Recombinant Human CSE1L Protein (1-200 aa), His-SUMO-tagged | +Inquiry |
| CSE1L-670H | Recombinant Human CSE1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| CSE1L-874R | Recombinant Rhesus Macaque CSE1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| CSE1L-1959H | Recombinant Human CSE1L Protein, GST-tagged | +Inquiry |
| CSE1L-11497Z | Recombinant Zebrafish CSE1L | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
