| Species : |
Human |
| Source : |
Wheat Germ |
| Tag : |
Non |
| Protein Length : |
195 amino acids |
| Description : |
Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. |
| Molecular Weight : |
47.520kDa inclusive of tags |
| Tissue specificity : |
Highly expressed in proliferating cells. |
| Form : |
Liquid |
| Purity : |
Proprietary Purification |
| Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQ NYPLLLLTLLEKSQDNVIKVCASVTFKNYIKRNWRIVEDE PNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRY RHEFKSNELWTEIKLVLDAFALPLTNLFKVWNASW |
| Sequence Similarities : |
Belongs to the XPO2/CSE1 family.Contains 1 importin N-terminal domain. |