Recombinant Human CSE1L
Cat.No. : | CSE1L-27953TH |
Product Overview : | Recombinant full length Human Cellular Apoptosis Susceptibility with N terminal proprietary tag, predicted mwt: 47.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 195 amino acids |
Description : | Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. |
Molecular Weight : | 47.520kDa inclusive of tags |
Tissue specificity : | Highly expressed in proliferating cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQ NYPLLLLTLLEKSQDNVIKVCASVTFKNYIKRNWRIVEDE PNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRY RHEFKSNELWTEIKLVLDAFALPLTNLFKVWNASW |
Sequence Similarities : | Belongs to the XPO2/CSE1 family.Contains 1 importin N-terminal domain. |
Gene Name | CSE1L CSE1 chromosome segregation 1-like (yeast) [ Homo sapiens ] |
Official Symbol | CSE1L |
Synonyms | CSE1L; CSE1 chromosome segregation 1-like (yeast); chromosome segregation 1 (yeast homolog) like; exportin-2; CAS; CSE1; XPO2; |
Gene ID | 1434 |
mRNA Refseq | NM_001316 |
Protein Refseq | NP_001307 |
MIM | 601342 |
Uniprot ID | P55060 |
Chromosome Location | 20q13 |
Pathway | Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem; |
Function | importin-alpha export receptor activity; protein binding; protein transporter activity; |
◆ Recombinant Proteins | ||
CSE1L-874R | Recombinant Rhesus Macaque CSE1L Protein, His (Fc)-Avi-tagged | +Inquiry |
CSE1L-27394TH | Recombinant Human CSE1L | +Inquiry |
CSE1L-2363H | Recombinant Human CSE1L protein, His-SUMO-tagged | +Inquiry |
CSE1L-670H | Recombinant Human CSE1L Protein, His (Fc)-Avi-tagged | +Inquiry |
CSE1L-9523HCL | Recombinant Human CSE1L Over-expression Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSE1L Products
Required fields are marked with *
My Review for All CSE1L Products
Required fields are marked with *