"CSF3R" Related Products

Expand
Expand
Expand

Recombinant Human CSF3R, Fc-tagged

Cat.No.: CSF3R-27467TH
Product Overview: Recombinant fragment, corresponding to amino acids 25-621 of Human GCSF Receptor fused to the Fc region of human IgG1 (aa 90-330) expressed in modified human 293 cells.
Description: The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia.
Conjugation: Fc
Tissue specificity: One or several isoforms have been found in myelogenous leukemia cell line KG-1, leukemia U937 cell line, in bone marrow cells, placenta, and peripheral blood granulocytes. Isoform GCSFR-2 is found only in leukemia U937 cells. Isoform GSCFR-3 is highly exp
Biological activity: The ED50 of CSF3R-27467TH is typically 2-3 ng/ml as measured by its ability to neutralize GCSF mediated proliferation of the murine myeloblastic m-NFS-60 cell line.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: Theoretical Sequence: ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQIL WRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLS CCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMNLTTS SLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILD CVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDPSPEAAPPQAGCLQLCWE PWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQY ELCGLLPATAYTLQIRCIRWPLPGHWSDWSPSLELRTT ERAPTVRLDTWWRQRQLDPRTVQLFWKPVPLEEDSGRI QGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPTPVVFSESRGPALTRLHAMARDPHSLW VGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRMEQNGR ATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYS QEMAPSHAPELHLKHIGKTWAQLEWVPEPPELGKSPLT HYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHLMAASQAGATNSTVLTLMTLTPRSSNTKVDKKVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Sequence Similarities: Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Gene Name: CSF3R colony stimulating factor 3 receptor (granulocyte) [ Homo sapiens ]
Official Symbol: CSF3R
Synonyms: CSF3R; colony stimulating factor 3 receptor (granulocyte); CD114; granulocyte colony-stimulating factor receptor; GCSFR;
Gene ID: 1441
mRNA Refseq: NM_000760
Protein Refseq: NP_000751
MIM: 138971
Uniprot ID: Q99062
Chromosome Location: 1p35-p34.3
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem;
Function: cytokine receptor activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.