Recombinant Human CSF3R, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CSF3R, Fc-tagged

Recombinant Human CSF3R, Fc-tagged

CSF3R Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CSF3R-27467TH
Product Overview : Recombinant fragment, corresponding to amino acids 25-621 of Human GCSF Receptor fused to the Fc region of human IgG1 (aa 90-330) expressed in modified human 293 cells.
Description : The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia.
Conjugation : Fc
Tissue specificity : One or several isoforms have been found in myelogenous leukemia cell line KG-1, leukemia U937 cell line, in bone marrow cells, placenta, and peripheral blood granulocytes. Isoform GCSFR-2 is found only in leukemia U937 cells. Isoform GSCFR-3 is highly exp
Biological activity : The ED50 of CSF3R-27467TH is typically 2-3 ng/ml as measured by its ability to neutralize GCSF mediated proliferation of the murine myeloblastic m-NFS-60 cell line.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : Theoretical Sequence: ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQIL WRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLS CCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMNLTTS SLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILD CVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDPSPEAAPPQAGCLQLCWE PWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQY ELCGLLPATAYTLQIRCIRWPLPGHWSDWSPSLELRTT ERAPTVRLDTWWRQRQLDPRTVQLFWKPVPLEEDSGRI QGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPTPVVFSESRGPALTRLHAMARDPHSLW VGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRMEQNGR ATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYS QEMAPSHAPELHLKHIGKTWAQLEWVPEPPELGKSPLT HYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHLMAASQAGATNSTVLTLMTLTPRSSNTKVDKKVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Sequence Similarities : Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Gene Name : CSF3R colony stimulating factor 3 receptor (granulocyte) [ Homo sapiens ]
Official Symbol : CSF3R
Synonyms : CSF3R; colony stimulating factor 3 receptor (granulocyte); CD114; granulocyte colony-stimulating factor receptor; GCSFR;
Gene ID : 1441
mRNA Refseq : NM_000760
Protein Refseq : NP_000751
MIM : 138971
Uniprot ID : Q99062
Chromosome Location : 1p35-p34.3
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem;
Function : cytokine receptor activity; receptor activity;
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2021 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy