Recombinant Human CST1, His-tagged
Cat.No. : | CST1-27161TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 21-141 of Human Cystatin SN with N terminal His tag; 145 amino acids, 16.9kDa. |
- Specification
- Gene Information
- Related Products
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. |
Protein length : | 121 amino acids |
Conjugation : | HIS |
Molecular Weight : | 16.900kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:10% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl, 0.03% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMWSPKEEDRIIPGGIYN ADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQ TVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQ LCSFEIYEVPWENRRSLVKS RCQES |
Sequence Similarities : | Belongs to the cystatin family. |
Gene Name : | CST1 cystatin SN [ Homo sapiens ] |
Official Symbol : | CST1 |
Synonyms : | CST1; cystatin SN; cystatin-SN; |
Gene ID : | 1469 |
mRNA Refseq : | NM_001898 |
Protein Refseq : | NP_001889 |
MIM : | 123855 |
Uniprot ID : | P01037 |
Chromosome Location : | 20p11.2 |
Pathway : | Salivary secretion, organism-specific biosystem; Salivary secretion, conserved biosystem; |
Function : | cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
CST1-2023H | Recombinant Human CST1 Protein, GST-tagged | +Inquiry |
CST1-191H | Recombinant Human CST1 Protein, His-tagged | +Inquiry |
CST1-2038H | Recombinant Human CST1 protein, His-tagged | +Inquiry |
CST1-1842H | Recombinant Human CST1 Protein (Trp21-Ser141), C-His tagged | +Inquiry |
CST1-11641H | Recombinant Human CST1, His-tagged | +Inquiry |
◆ Lysates | ||
CST1-1930HCL | Recombinant Human CST1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket