"DDX11" Related Products

Expand

Recombinant Human DDX11, GST-tagged

Cat.No.: DDX11-28322TH
Product Overview: Recombinant Human DDX11(40 a.a. - 129 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an enzyme that possesses both ATPase and DNA helicase activities. This gene is a homolog of the yeast CHL1 gene, and may function to maintain chromosome transmission fidelity and genome stability. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 35.64 kDa
AA Sequence: GIFESPTGTGKSLSLICGALSWLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWV TQFVQKKEERDLVDR
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: DDX11 DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 [ Homo sapiens (human) ]
Official Symbol: DDX11
Synonyms: DDX11; CHL1; KRG2; WABS; CHLR1; DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11; probable ATP-dependent RNA helicase DDX11; KRG-2; hCHLR1; DEAD/H box protein 11; CHL1-related protein 1; CHL1-like helicase homolog; CHL1-related helicase gene-1; keratinocyte growth factor-regulated gene 2 protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S. cerevisiae); NP_001244073.1; EC 3.6.4.13; NP_001244074.1; NP_004390.3; NP_085911.2; NP_689651.1
Gene ID: 1663
mRNA Refseq: NM_001257144
Protein Refseq: NP_001244073
MIM: 601150
UniProt ID: Q96FC9
Chromosome Location: 12p11
Pathway: Activation of Chaperone Genes by XBP1(S); Activation of Chaperones by IRE1alpha; Metabolism of proteins
Function: 4 iron, 4 sulfur cluster binding; ATP-dependent DNA helicase activity; DNA helicase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.