Recombinant Human DDX11, GST-tagged
Cat.No. : | DDX11-28322TH |
Product Overview : | Recombinant Human DDX11(40 a.a. - 129 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an enzyme that possesses both ATPase and DNA helicase activities. This gene is a homolog of the yeast CHL1 gene, and may function to maintain chromosome transmission fidelity and genome stability. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Molecular Mass : | 35.64 kDa |
AA Sequence : | GIFESPTGTGKSLSLICGALSWLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWV TQFVQKKEERDLVDR |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDX11 DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11 [ Homo sapiens (human) ] |
Official Symbol | DDX11 |
Synonyms | DDX11; CHL1; KRG2; WABS; CHLR1; DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11; probable ATP-dependent RNA helicase DDX11; KRG-2; hCHLR1; DEAD/H box protein 11; CHL1-related protein 1; CHL1-like helicase homolog; CHL1-related helicase gene-1; keratinocyte growth factor-regulated gene 2 protein; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S. cerevisiae); NP_001244073.1; EC 3.6.4.13; NP_001244074.1; NP_004390.3; NP_085911.2; NP_689651.1 |
Gene ID | 1663 |
mRNA Refseq | NM_001257144 |
Protein Refseq | NP_001244073 |
MIM | 601150 |
UniProt ID | Q96FC9 |
Chromosome Location | 12p11 |
Pathway | Activation of Chaperone Genes by XBP1(S); Activation of Chaperones by IRE1alpha; Metabolism of proteins |
Function | 4 iron, 4 sulfur cluster binding; ATP-dependent DNA helicase activity; DNA helicase activity |
◆ Recombinant Proteins | ||
DDX11-28322TH | Recombinant Human DDX11, GST-tagged | +Inquiry |
DDX11-11890H | Recombinant Human DDX11, GST-tagged | +Inquiry |
DDX11-1711Z | Recombinant Zebrafish DDX11 | +Inquiry |
DDX11-4399M | Recombinant Mouse DDX11 Protein | +Inquiry |
DDX11-2263M | Recombinant Mouse DDX11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX11-454HCL | Recombinant Human DDX11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDX11 Products
Required fields are marked with *
My Review for All DDX11 Products
Required fields are marked with *
0
Inquiry Basket