Recombinant Human DIRAS3, His-tagged

Cat.No. : DIRAS3-27416TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-229 of Human ARHI with N terminal His tag, 31kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-229 a.a.
Description : This gene is a member of the ras superfamily, and is expressed in normal ovarian and breast epithelial cells, but not in ovarian and breast cancers. It is an imprinted gene, with monoallelic expression of the paternal allele, which is associated with growth suppression. Thus, this gene appears to be a putative tumor suppressor gene whose function is abrogated in ovarian and breast cancers.
Conjugation : HIS
Tissue specificity : Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.
Form : Lyophilised:Reconstitute with 132 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRV VVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLL GCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSV TKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDD THREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHM LLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Sequence Similarities : Belongs to the small GTPase superfamily. Di-Ras family.
Full Length : Full L.
Gene Name DIRAS3 DIRAS family, GTP-binding RAS-like 3 [ Homo sapiens ]
Official Symbol DIRAS3
Synonyms DIRAS3; DIRAS family, GTP-binding RAS-like 3; ARHI, ras homolog gene family, member I; GTP-binding protein Di-Ras3; NOEY2;
Gene ID 9077
mRNA Refseq NM_004675
Protein Refseq NP_004666
MIM 605193
Uniprot ID O95661
Chromosome Location 1p31
Function GTP binding; GTPase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DIRAS3 Products

Required fields are marked with *

My Review for All DIRAS3 Products

Required fields are marked with *

0
cart-icon
0
compare icon