Recombinant Human DIRAS3, His-tagged DIRAS3-27416TH

Recombinant Human DIRAS3, His-tagged

PRODUCTS

Home / Products / Recombinant Human DIRAS3, His-tagged

Recombinant Human DIRAS3, His-tagged

DIRAS3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DIRAS3-27416TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-229 of Human ARHI with N terminal His tag, 31kDa.
Description : This gene is a member of the ras superfamily, and is expressed in normal ovarian and breast epithelial cells, but not in ovarian and breast cancers. It is an imprinted gene, with monoallelic expression of the paternal allele, which is associated with growth suppression. Thus, this gene appears to be a putative tumor suppressor gene whose function is abrogated in ovarian and breast cancers.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.
Form : Lyophilised:Reconstitute with 132 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRV VVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLL GCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSV TKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDD THREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHM LLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Sequence Similarities : Belongs to the small GTPase superfamily. Di-Ras family.
Gene Name : DIRAS3 DIRAS family, GTP-binding RAS-like 3 [ Homo sapiens ]
Official Symbol : DIRAS3
Synonyms : DIRAS3; DIRAS family, GTP-binding RAS-like 3; ARHI, ras homolog gene family, member I; GTP-binding protein Di-Ras3; NOEY2;
Gene ID : 9077
mRNA Refseq : NM_004675
Protein Refseq : NP_004666
MIM : 605193
Uniprot ID : O95661
Chromosome Location : 1p31
Function : GTP binding; GTPase activity; nucleotide binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy