Active Recombinant Full Length Human DIRAS3 Protein, C-Flag-tagged
Cat.No. : | DIRAS3-292HFL |
Product Overview : | Recombinant Full Length Human DIRAS3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vitro kinase assay substrate (negative control) |
Molecular Mass : | 25.7 kDa |
AA Sequence : | MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE KKSQMPNTTEKLLDKCIIMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DIRAS3 DIRAS family GTPase 3 [ Homo sapiens (human) ] |
Official Symbol | DIRAS3 |
Synonyms | ARHI; NOEY2 |
Gene ID | 9077 |
mRNA Refseq | NM_004675.5 |
Protein Refseq | NP_004666.1 |
MIM | 605193 |
UniProt ID | O95661 |
◆ Recombinant Proteins | ||
DIRAS3-27416TH | Recombinant Human DIRAS3, His-tagged | +Inquiry |
DIRAS3-764H | Recombinant Human DIRAS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DIRAS3-1094R | Recombinant Rhesus Macaque DIRAS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DIRAS3-6778H | Recombinant Human DIRAS3 protein, His-tagged | +Inquiry |
DIRAS3-2638H | Recombinant Human DIRAS3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIRAS3-779HCL | Recombinant Human DIRAS3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DIRAS3 Products
Required fields are marked with *
My Review for All DIRAS3 Products
Required fields are marked with *
0
Inquiry Basket