Recombinant Full Length Human DIRAS3 Protein, GST-tagged
| Cat.No. : | DIRAS3-2573HF |
| Product Overview : | Human DIRAS3 full-length ORF ( AAH05362, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 229 amino acids |
| Description : | This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 50.93 kDa |
| AA Sequence : | MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DIRAS3 DIRAS family, GTP-binding RAS-like 3 [ Homo sapiens ] |
| Official Symbol | DIRAS3 |
| Synonyms | DIRAS3; DIRAS family, GTP-binding RAS-like 3; ARHI, ras homolog gene family, member I; GTP-binding protein Di-Ras3; NOEY2; ras homolog gene family, member I; rho-related GTP-binding protein RhoI; distinct subgroup of the Ras family member 3; ARHI; |
| Gene ID | 9077 |
| mRNA Refseq | NM_004675 |
| Protein Refseq | NP_004666 |
| MIM | 605193 |
| UniProt ID | O95661 |
| ◆ Recombinant Proteins | ||
| DIRAS3-0267H | Recombinant Human DIRAS3 protein, mFc-tagged | +Inquiry |
| DIRAS3-1269R | Recombinant Rhesus monkey DIRAS3 Protein, His-tagged | +Inquiry |
| DIRAS3-2638H | Recombinant Human DIRAS3 Protein, GST-tagged | +Inquiry |
| DIRAS3-4624H | Recombinant Human DIRAS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DIRAS3-6778H | Recombinant Human DIRAS3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DIRAS3-779HCL | Recombinant Human DIRAS3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS3 Products
Required fields are marked with *
My Review for All DIRAS3 Products
Required fields are marked with *
