"DPPA4" Related Products

Recombinant Human DPPA4, His-tagged

Cat.No.: DPPA4-28438TH
Product Overview: Recombinant fragment, corresponding to amino acids 5-304 of Human Dppa4 with an N terminal His tag; Predicted MWt 34 kDa;
Description: Little is known about the Dppa4 gene, which is from the Dppa family of developmental pluripotency associated transcription factors. Dppa4 is a target of Oct4, Sox2 and Nanog.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 157 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGT SAKRTKEKMSIKGSKVLCPKKKAEHTDNPRPQKKIPIP PLPSKLPPVNLIHRDILRAWCQQLKLSSKGQKLDAYKR LCAFAYPNQKDFPSTAKEAKIRKSLQKKLKVEKGETSL QSSETHPPEVALPPVGEPPALENSTALLEGVNTVVVTTSA PEALLASWARISARARTPEAVESPQEASGVRWCVVHGK SLPADTDGWVHLQFHAGQAWVPEKQEGRVSALFLLPAS NFPPPHLEDNMLCPKCVHRNKVLIKSLQWE
Gene Name: DPPA4 developmental pluripotency associated 4 [ Homo sapiens ]
Official Symbol: DPPA4
Synonyms: DPPA4; developmental pluripotency associated 4; developmental pluripotency-associated protein 4; FLJ10713;
Gene ID: 55211
mRNA Refseq: NM_018189
Protein Refseq: NP_060659
MIM: 614125
Uniprot ID: Q7L190
Chromosome Location: 3q13.13
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.