"DYRK1A" Related Products

Expand
Expand

Recombinant Human DYRK1A

Cat.No.: DYRK1A-26456TH
Product Overview: Recombinant fragment of Human DYRK1A protein with an N terminal proprietary tag; predicted mwt: 35.53 kDa inclusive of tag.
Description: This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5 UTR or in the 3 coding region. These variants encode at least five different isoforms.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVAS
Gene Name: DYRK1A dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A [ Homo sapiens ]
Official Symbol: DYRK1A
Synonyms: DYRK1A; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A; DYRK, DYRK1, MNBH; dual specificity tyrosine-phosphorylation-regulated kinase 1A;
Gene ID: 1859
mRNA Refseq: NM_001396
Protein Refseq: NP_001387
MIM: 600855
Uniprot ID: Q13627
Chromosome Location: 21q22.13
Pathway: Cell Cycle, Mitotic, organism-specific biosystem; G0 and Early G1, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Mitotic G1-G1/S phases, organism-specific biosystem;
Function: ATP binding; kinase activity; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.