Recombinant Human DYRK1A Protein, GST-tagged

Cat.No. : DYRK1A-2982H
Product Overview : Human DYRK1A partial ORF ( NP_001387, 674 a.a. - 763 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5' UTR or in the 3' coding region. These variants encode at least five different isoforms. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.53 kDa
AA Sequence : NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DYRK1A dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A [ Homo sapiens ]
Official Symbol DYRK1A
Synonyms DYRK1A; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A; DYRK, DYRK1, MNBH; dual specificity tyrosine-phosphorylation-regulated kinase 1A; hMNB; MNB/DYRK protein kinase; serine/threonine kinase MNB; mnb protein kinase homolog hp86; protein kinase minibrain homolog; dual specificity YAK1-related kinase; serine/threonine-specific protein kinase; MNB; DYRK; HP86; MNBH; MRD7; DYRK1;
Gene ID 1859
mRNA Refseq NM_001396
Protein Refseq NP_001387
MIM 600855
UniProt ID Q13627

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DYRK1A Products

Required fields are marked with *

My Review for All DYRK1A Products

Required fields are marked with *

0
cart-icon
0
compare icon