"EDC4" Related Products

Expand
Expand

Recombinant Human EDC4, His-tagged

Cat.No.: EDC4-28226TH
Product Overview: Recombinant fragment, corresponding to amino acids 1143-1385 of Human EDC4 with an N-terminal His Tag, approximately 28kDa
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 46 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LGTQEYLQQLESHMKSRKAREQEAREPVLAQLRGLVSTLQ SATEQMAATVAGSVRAEVQHQLHVAVGSLQESILAQVQ RIVKGEVSVALKEQQAAVTSSIMQAMRSAAGTPVPSAHLDCQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCE TVDPAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLK LSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAA
Sequence Similarities: Belongs to the WD repeat EDC4 family.Contains 4 WD repeats.
Gene Name: EDC4 enhancer of mRNA decapping 4 [ Homo sapiens ]
Official Symbol: EDC4
Synonyms: EDC4; enhancer of mRNA decapping 4; enhancer of mRNA-decapping protein 4; Ge 1; HEDLS; RCD 8;
Gene ID: 23644
mRNA Refseq: NM_014329
Protein Refseq: NP_055144
MIM: 606030
Uniprot ID: Q6P2E9
Chromosome Location: 16q22.1
Pathway: Deadenylation-dependent mRNA decay, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; RNA degradation, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.