"EDNRA" Related Products

Expand
Expand
Expand

Recombinant Human EDNRA

Cat.No.: EDNRA-28562TH
Product Overview: Recombinant fragment of Human Endothelin A Receptor with N terminal proprietary tag, 32.56kDa inclusive of tag.
Description: This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants.
Protein length: 63 amino acids
Molecular Weight: 32.560kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and li
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily.
Gene Name: EDNRA endothelin receptor type A [ Homo sapiens ]
Official Symbol: EDNRA
Synonyms: EDNRA; endothelin receptor type A; endothelin-1 receptor;
Gene ID: 1909
mRNA Refseq: NM_001166055
Protein Refseq: NP_001159527
MIM: 131243
Uniprot ID: P25101
Chromosome Location: 4
Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; EGFR-dependent Endothelin signaling events, organism-specific biosystem; Endothelins, organism-specific biosystem;
Function: G-protein coupled receptor activity; endothelin receptor activity; phosphatidylinositol phospholipase C activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.