Recombinant Human EDNRA

Cat.No. : EDNRA-28562TH
Product Overview : Recombinant fragment of Human Endothelin A Receptor with N terminal proprietary tag, 32.56kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 63 amino acids
Description : This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants.
Molecular Weight : 32.560kDa inclusive of tags
Tissue specificity : Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and li
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily.
Gene Name EDNRA endothelin receptor type A [ Homo sapiens ]
Official Symbol EDNRA
Synonyms EDNRA; endothelin receptor type A; endothelin-1 receptor;
Gene ID 1909
mRNA Refseq NM_001166055
Protein Refseq NP_001159527
MIM 131243
Uniprot ID P25101
Chromosome Location 4
Pathway Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; EGFR-dependent Endothelin signaling events, organism-specific biosystem; Endothelins, organism-specific biosystem;
Function G-protein coupled receptor activity; endothelin receptor activity; phosphatidylinositol phospholipase C activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EDNRA Products

Required fields are marked with *

My Review for All EDNRA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon