"EIF2AK4" Related Products

Recombinant Human EIF2AK4

Cat.No.: EIF2AK4-28160TH
Product Overview: Recombinant fragment of Human GCN2 with proprietary tag, 36.63kDa.
Description: EIF2AK4 belongs to a family of kinases that phosphorylate the alpha subunit of eukaryotic translation initiation factor-2 (EIF2S1; MIM 603907) to downregulate protein synthesis in response to varied cellular stresses (Berlanga et al.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: YETQVQTRLQTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF
Sequence Similarities: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.Contains 2 protein kinase domains.Contains 1 RWD domain.
Gene Name: EIF2AK4 eukaryotic translation initiation factor 2 alpha kinase 4 [ Homo sapiens ]
Official Symbol: EIF2AK4
Synonyms: EIF2AK4; eukaryotic translation initiation factor 2 alpha kinase 4; eukaryotic translation initiation factor 2-alpha kinase 4; GCN2; KIAA1338;
Gene ID: 440275
mRNA Refseq: NM_001013703
Protein Refseq: NP_001013725
MIM: 609280
Uniprot ID: Q9P2K8
Chromosome Location: 15q13.3
Pathway: Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Influenza A, organism-specific biosystem;
Function: ATP binding; aminoacyl-tRNA ligase activity; eukaryotic translation initiation factor 2alpha kinase activity; nucleotide binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.