Recombinant Human EIF2AK4 protein, His-tagged
| Cat.No. : | EIF2AK4-3346H |
| Product Overview : | Recombinant Human EIF2AK4 protein, fused to His tag, was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AFSADSKQDDQTGDLIKSDPSGHLTGMVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLTNVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | EIF2AK4 eukaryotic translation initiation factor 2 alpha kinase 4 [ Homo sapiens ] |
| Official Symbol | EIF2AK4 |
| Synonyms | EIF2AK4; eukaryotic translation initiation factor 2 alpha kinase 4; eukaryotic translation initiation factor 2-alpha kinase 4; GCN2; KIAA1338; GCN2-like protein; GCN2 eIF2alpha kinase; |
| Gene ID | 440275 |
| mRNA Refseq | NM_001013703 |
| Protein Refseq | NP_001013725 |
| MIM | 609280 |
| UniProt ID | Q9P2K8 |
| ◆ Recombinant Proteins | ||
| EIF2AK4-2700M | Recombinant Mouse EIF2AK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF2AK4-3153H | Recombinant Human EIF2AK4 Protein, GST-tagged | +Inquiry |
| EIF2AK4-1414H | Recombinant Human EIF2AK4 Protein, His-tagged | +Inquiry |
| EIF2AK4-7854H | Recombinant Human EIF2AK4 protein, GST-tagged | +Inquiry |
| EIF2AK4-1011H | Recombinant Human Eukaryotic Translation Initiation Factor 2 Alpha Kinase 4, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF2AK4-342HKCL | Human EIF2AK4 Knockdown Cell Lysate | +Inquiry |
| EIF2AK4-6672HCL | Recombinant Human EIF2AK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2AK4 Products
Required fields are marked with *
My Review for All EIF2AK4 Products
Required fields are marked with *
