"EIF3M" Related Products

Expand
Expand
Expand

Recombinant Human EIF3M, His-tagged

Cat.No.: EIF3M-29960TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-374 of Human PCID1 with N terminal His tag; Predicted MWt 44 kDa.
Description: HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al.
Conjugation: HIS
Source: E. coli
Tissue specificity: Broadly expressed.
Form: Lyophilised:Reconstitute with 159 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHV DLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDK QEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKN TPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDW NLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFL EGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLH EQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDV EAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQ WQQLYDTLNAWKQNLNKVKNSLLSLSDT
Sequence Similarities: Belongs to the eIF-3 subunit M family.Contains 1 PCI domain.
Gene Name: EIF3M eukaryotic translation initiation factor 3, subunit M [ Homo sapiens ]
Official Symbol: EIF3M
Synonyms: EIF3M; eukaryotic translation initiation factor 3, subunit M; PCI domain containing 1 (herpesvirus entry mediator) , PCID1; eukaryotic translation initiation factor 3 subunit M; eIF3m; FLJ29030; GA17; hfl B5;
Gene ID: 10480
mRNA Refseq: NM_006360
Protein Refseq: NP_006351
MIM: 609641
Uniprot ID: Q7L2H7
Chromosome Location: 11p13
Function: protein binding; contributes_to translation initiation factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.