"ENPEP" Related Products

Expand
Expand
Expand

Recombinant Human ENPEP, GST-tagged

Cat.No.: ENPEP-27665TH
Product Overview: Recombinant fragment: DLHVKPLLE EDTYTGTVSI SINLSAPTRY LWLHLRETRI TRLPELKRPS GDQVQVRRCF EYKKQEY, corresponding to amino acids 103-168 of Human BP1; GST tag is about 25-26 kDa and BP1 with GST tag is about 35 kDa.66 amino acids, 35kDa.
Description: Glutamyl aminopeptidase also known as aminopeptidase A is an enzyme encoded by the ENPEP gene. Glutamyl aminopeptidase has also recently been designated CD249 (cluster of differentiation 249).
Conjugation: GST
Source: E. coli
Tissue specificity: Expressed by epithelial cells of the proximal tubule cells and the glomerulus of the nephron. Also found in a variety of other tissues.
Form: Liquid
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 50mM Tris acetate, 1mM EDTA, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: DLHVKPLL EEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEY
Sequence Similarities: Belongs to the peptidase M1 family.
Gene Name: ENPEP glutamyl aminopeptidase (aminopeptidase A) [ Homo sapiens ]
Official Symbol: ENPEP
Synonyms: ENPEP; glutamyl aminopeptidase (aminopeptidase A); glutamyl aminopeptidase; CD249; gp160;
Gene ID: 2028
mRNA Refseq: NM_001977
Protein Refseq: NP_001968
MIM: 138297
Uniprot ID: Q07075
Chromosome Location: 4q25
Pathway: Renin-angiotensin system, organism-specific biosystem; Renin-angiotensin system, conserved biosystem;
Function: aminopeptidase activity; metal ion binding; metalloexopeptidase activity; peptidase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.