Recombinant Human ENPEP, GST-tagged

Cat.No. : ENPEP-27665TH
Product Overview : Recombinant fragment: DLHVKPLLE EDTYTGTVSI SINLSAPTRY LWLHLRETRI TRLPELKRPS GDQVQVRRCF EYKKQEY, corresponding to amino acids 103-168 of Human BP1; GST tag is about 25-26 kDa and BP1 with GST tag is about 35 kDa.66 amino acids, 35kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 103-168 a.a.
Description : Glutamyl aminopeptidase also known as aminopeptidase A is an enzyme encoded by the ENPEP gene. Glutamyl aminopeptidase has also recently been designated CD249 (cluster of differentiation 249).
Conjugation : GST
Tissue specificity : Expressed by epithelial cells of the proximal tubule cells and the glomerulus of the nephron. Also found in a variety of other tissues.
Form : Liquid
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 50mM Tris acetate, 1mM EDTA, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : DLHVKPLL EEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEY
Sequence Similarities : Belongs to the peptidase M1 family.
Gene Name ENPEP glutamyl aminopeptidase (aminopeptidase A) [ Homo sapiens ]
Official Symbol ENPEP
Synonyms ENPEP; glutamyl aminopeptidase (aminopeptidase A); glutamyl aminopeptidase; CD249; gp160;
Gene ID 2028
mRNA Refseq NM_001977
Protein Refseq NP_001968
MIM 138297
Uniprot ID Q07075
Chromosome Location 4q25
Pathway Renin-angiotensin system, organism-specific biosystem; Renin-angiotensin system, conserved biosystem;
Function aminopeptidase activity; metal ion binding; metalloexopeptidase activity; peptidase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENPEP Products

Required fields are marked with *

My Review for All ENPEP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon