Recombinant Human EYA3 EYA3-26817TH

Recombinant Human EYA3

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human EYA3

Recombinant Human EYA3

EYA3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : EYA3-26817TH
Product Overview : Recombinant fragment of Human EYA3 with an N terminal proprietary tag; Predicted MW 36.96kDa.
Description : This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator.
Protein length : 103 amino acids
Molecular Weight : 36.960kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLD ETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVA DTHLFFNDLEECDQVHVEDVASD
Sequence Similarities : Belongs to the HAD-like hydrolase superfamily. EYA family.
Gene Name : EYA3 eyes absent homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol : EYA3
Synonyms : EYA3; eyes absent homolog 3 (Drosophila); eyes absent (Drosophila) homolog 3; eyes absent homolog 3; DKFZp686C132;
Gene ID : 2140
mRNA Refseq : NM_001990
Protein Refseq : NP_001981
MIM : 601655
Uniprot ID : Q99504
Chromosome Location : 1p36
Function : catalytic activity; hydrolase activity; metal ion binding; protein binding; protein tyrosine phosphatase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy