Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human EYA3

Cat.No. : EYA3-26817TH
Product Overview : Recombinant fragment of Human EYA3 with an N terminal proprietary tag; Predicted MW 36.96kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator.
Protein length : 103 amino acids
Molecular Weight : 36.960kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLD ETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVA DTHLFFNDLEECDQVHVEDVASD
Sequence Similarities : Belongs to the HAD-like hydrolase superfamily. EYA family.
Gene Name : EYA3 eyes absent homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol : EYA3
Synonyms : EYA3; eyes absent homolog 3 (Drosophila); eyes absent (Drosophila) homolog 3; eyes absent homolog 3; DKFZp686C132;
Gene ID : 2140
mRNA Refseq : NM_001990
Protein Refseq : NP_001981
MIM : 601655
Uniprot ID : Q99504
Chromosome Location : 1p36
Function : catalytic activity; hydrolase activity; metal ion binding; protein binding; protein tyrosine phosphatase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends