Recombinant Human EYA3

• Cat.No.: EYA3-26817TH
• Product Overview: Recombinant fragment of Human EYA3 with an N terminal proprietary tag; Predicted MW 36.96kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 103 amino acids
• Description: This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator.
• Molecular Weight: 36.960kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLD ETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVA DTHLFFNDLEECDQVHVEDVASD
• Sequence Similarities: Belongs to the HAD-like hydrolase superfamily. EYA family.

Gene Information

• Gene Name: EYA3 eyes absent homolog 3 (Drosophila) [ Homo sapiens ]
• Official Symbol: EYA3
• Synonyms: EYA3; eyes absent homolog 3 (Drosophila); eyes absent (Drosophila) homolog 3; eyes absent homolog 3; DKFZp686C132
• Gene ID: 2140
• mRNA Refseq: NM_001990
• Protein Refseq: NP_001981
• MIM: 601655
• Uniprot ID: Q99504
• Chromosome Location: 1p36
• Function: catalytic activity; hydrolase activity; metal ion binding; protein binding; protein tyrosine phosphatase activity