Recombinant Human EYA3
| Cat.No. : | EYA3-26817TH |
| Product Overview : | Recombinant fragment of Human EYA3 with an N terminal proprietary tag; Predicted MW 36.96kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 103 amino acids |
| Description : | This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator. |
| Molecular Weight : | 36.960kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLD ETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVA DTHLFFNDLEECDQVHVEDVASD |
| Sequence Similarities : | Belongs to the HAD-like hydrolase superfamily. EYA family. |
| Gene Name | EYA3 eyes absent homolog 3 (Drosophila) [ Homo sapiens ] |
| Official Symbol | EYA3 |
| Synonyms | EYA3; eyes absent homolog 3 (Drosophila); eyes absent (Drosophila) homolog 3; eyes absent homolog 3; DKFZp686C132; |
| Gene ID | 2140 |
| mRNA Refseq | NM_001990 |
| Protein Refseq | NP_001981 |
| MIM | 601655 |
| Uniprot ID | Q99504 |
| Chromosome Location | 1p36 |
| Function | catalytic activity; hydrolase activity; metal ion binding; protein binding; protein tyrosine phosphatase activity; |
| ◆ Recombinant Proteins | ||
| EYA3-1526R | Recombinant Rhesus monkey EYA3 Protein, His-tagged | +Inquiry |
| EYA3-4458HF | Recombinant Full Length Human EYA3 Protein, GST-tagged | +Inquiry |
| EYA3-26817TH | Recombinant Human EYA3 | +Inquiry |
| EYA3-1351R | Recombinant Rhesus Macaque EYA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EYA3-4993Z | Recombinant Zebrafish EYA3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EYA3 Products
Required fields are marked with *
My Review for All EYA3 Products
Required fields are marked with *
