Recombinant Human EYA3
Cat.No. : | EYA3-26817TH |
Product Overview : | Recombinant fragment of Human EYA3 with an N terminal proprietary tag; Predicted MW 36.96kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator. |
Protein length : | 103 amino acids |
Molecular Weight : | 36.960kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KDTDDQSRKNMTSKNRGKRKADATSSQDSELERVFLWDLD ETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVA DTHLFFNDLEECDQVHVEDVASD |
Sequence Similarities : | Belongs to the HAD-like hydrolase superfamily. EYA family. |
Gene Name : | EYA3 eyes absent homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol : | EYA3 |
Synonyms : | EYA3; eyes absent homolog 3 (Drosophila); eyes absent (Drosophila) homolog 3; eyes absent homolog 3; DKFZp686C132; |
Gene ID : | 2140 |
mRNA Refseq : | NM_001990 |
Protein Refseq : | NP_001981 |
MIM : | 601655 |
Uniprot ID : | Q99504 |
Chromosome Location : | 1p36 |
Function : | catalytic activity; hydrolase activity; metal ion binding; protein binding; protein tyrosine phosphatase activity; |
Products Types
◆ Recombinant Protein | ||
EYA3-2911M | Recombinant Mouse EYA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EYA3-1351R | Recombinant Rhesus Macaque EYA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EYA3-3593H | Recombinant Human EYA3 Protein, GST-tagged | +Inquiry |
EYA3-5398M | Recombinant Mouse EYA3 Protein | +Inquiry |
EYA3-4993Z | Recombinant Zebrafish EYA3 | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket