Recombinant Human EZH2, His-tagged
Cat.No. : | EZH2-29233TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 558-707 of Human KMT6/EZH2 isoform 3 with an N-terminal His Tag, 150 amino aicds, approximately 24kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in many tissues. Overexpressed in numerous tumor types including carcinomas of the breast, colon, larynx, lymphoma and testis. |
Form : | Lyophilised:reconstitution with 60 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNE FISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFV VDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFA KRAIQTGEELFFDYRYSQADALKYVGIEREMEIP |
Sequence Similarities : | Belongs to the histone-lysine methyltransferase family. EZ subfamily.Contains 1 SET domain. |
Gene Name : | EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol : | EZH2 |
Synonyms : | EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A; |
Gene ID : | 2146 |
mRNA Refseq : | NM_001203247 |
Protein Refseq : | NP_001190176 |
MIM : | 601573 |
Uniprot ID : | Q15910 |
Chromosome Location : | 7q35-q36 |
Function : | DNA binding; histone methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
EZH2-1353R | Recombinant Rhesus Macaque EZH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EZH2-46H | Recombinant Human EZH2 Protein, His-tagged | +Inquiry |
Ezh2-991M | Recombinant Mouse Ezh2 Protein, MYC/DDK-tagged | +Inquiry |
EZH2-879H | Recombinant Human EZH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EZH2-285H | Recombinant Human EZH2 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
EZH2-6487HCL | Recombinant Human EZH2 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1726 | EZH2 Chemiluminescent Assay Kit | +Inquiry |
Kit-1727 | EZH2 Homogeneous Assay Kit | +Inquiry |
Kit-1725 | EZH2 (Y641N) Chemiluminescent Assay Kit | +Inquiry |
Kit-1723 | EZH2 (A677G) Chemiluminescent Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionEZH2 overexpression is associated with promoting tumor cell proliferation, invasion, and metastasis, leading to cancer progression.
EZH2 has been implicated in various non-oncological conditions, including cardiovascular diseases and neurodegenerative disorders.
Potential side effects may include hematological toxicity, gastrointestinal issues, and liver enzyme elevation.
Small molecule inhibitors of EZH2 have been developed and are being investigated as potential cancer therapies.
High EZH2 expression has been associated with poor prognosis in several cancer types.
Customer Reviews (3)
Write a reviewThe versatility of the EZH2 protein is truly remarkable, as it can be employed across a wide range of applications in my research.
In addition to its outstanding quality, the manufacturer of the EZH2 protein offers excellent technical support that can effectively address any challenges I may encounter.
Their dedicated team of experts is readily available to provide guidance and assistance, ensuring a seamless integration of the EZH2 protein into my experimental setup.
Ask a Question for All EZH2 Products
Required fields are marked with *
My Review for All EZH2 Products
Required fields are marked with *
Inquiry Basket