Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human EZH2, His-tagged

Cat.No. : EZH2-29233TH
Product Overview : Recombinant fragment, corresponding to amino acids 558-707 of Human KMT6/EZH2 isoform 3 with an N-terminal His Tag, 150 amino aicds, approximately 24kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in many tissues. Overexpressed in numerous tumor types including carcinomas of the breast, colon, larynx, lymphoma and testis.
Form : Lyophilised:reconstitution with 60 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNE FISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFV VDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFA KRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
Sequence Similarities : Belongs to the histone-lysine methyltransferase family. EZ subfamily.Contains 1 SET domain.
Gene Name : EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol : EZH2
Synonyms : EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A;
Gene ID : 2146
mRNA Refseq : NM_001203247
Protein Refseq : NP_001190176
MIM : 601573
Uniprot ID : Q15910
Chromosome Location : 7q35-q36
Function : DNA binding; histone methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
How is EZH2 overexpression associated with cancer progression? 11/20/2019

EZH2 overexpression is associated with promoting tumor cell proliferation, invasion, and metastasis, leading to cancer progression.

Are there any non-oncological clinical applications of EZH2? 07/29/2019

EZH2 has been implicated in various non-oncological conditions, including cardiovascular diseases and neurodegenerative disorders.

What are the potential side effects of EZH2 inhibitors in clinical use? 03/15/2017

Potential side effects may include hematological toxicity, gastrointestinal issues, and liver enzyme elevation.

How can EZH2 be targeted for cancer therapy? 08/17/2016

Small molecule inhibitors of EZH2 have been developed and are being investigated as potential cancer therapies.

Are there any prognostic implications of EZH2 expression in cancer patients? 08/15/2016

High EZH2 expression has been associated with poor prognosis in several cancer types.

Customer Reviews (3)

Write a review
Reviews
10/17/2022

    The versatility of the EZH2 protein is truly remarkable, as it can be employed across a wide range of applications in my research.

    03/14/2018

      In addition to its outstanding quality, the manufacturer of the EZH2 protein offers excellent technical support that can effectively address any challenges I may encounter.

      02/27/2018

        Their dedicated team of experts is readily available to provide guidance and assistance, ensuring a seamless integration of the EZH2 protein into my experimental setup.

        Ask a Question for All EZH2 Products

        Required fields are marked with *

        My Review for All EZH2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends