Recombinant Human EZH2 Protein, His-tagged
Cat.No. : | EZH2-42H |
Product Overview : | Recombinant Human EZH2(C-term-306aa) fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | C-term-306aa |
Description : | This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. |
Form : | The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol. |
AA Sequence : | RVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | EZH2 |
Synonyms | EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A; lysine N-methyltransferase 6; ENX1; WVS2; ENX-1; MGC9169; |
Gene ID | 2146 |
mRNA Refseq | NM_004456 |
Protein Refseq | NP_004447 |
MIM | 601573 |
UniProt ID | Q15910 |
◆ Recombinant Proteins | ||
EZH2-2486H | Recombinant Human EZH2 protein, His-tagged | +Inquiry |
EZH2-2908H | Recombinant Human EZH2 Protein | +Inquiry |
EZH2-2906H | Recombinant Human EZH2 Protein (Asn371-Pro746), N-GST tagged | +Inquiry |
EZH2-45H | Recombinant Human EZH2 protein, His-tagged | +Inquiry |
EZH2-5744H | Recombinant Human EZH2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EZH2-6487HCL | Recombinant Human EZH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EZH2 Products
Required fields are marked with *
My Review for All EZH2 Products
Required fields are marked with *
0
Inquiry Basket