Recombinant Human FGF13 FGF13-27598TH

Recombinant Human FGF13

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FGF13

Recombinant Human FGF13

FGF13 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FGF13-27598TH
Product Overview : Recombinant full length Human FGF13 containing an N-terminal proprietary tag; Predicted MW 52.69 kDa.
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Alternative splicing of this gene at the 5 end results in several transcript variants encoding different isoforms with different N-termini.
Protein length : 245 amino acids
Molecular Weight : 52.690kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Nervous system.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDK NKLNVFSRVKLFGSKKRRRRRPEPQLKGIATKLYSRQGYH LQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIY RQQQSGRGWYLGLNKEGEIMKGDHVKKNKPAAHFLPKPLK VAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS HNEST
Sequence Similarities : Belongs to the heparin-binding growth factors family.
Gene Name : FGF13 fibroblast growth factor 13 [ Homo sapiens ]
Official Symbol : FGF13
Synonyms : FGF13; fibroblast growth factor 13; FGF2; FHF2; fibroblast growth factor homologous factor 2;
Gene ID : 2258
mRNA Refseq : NM_001139498
Protein Refseq : NP_001132970
MIM : 300070
Uniprot ID : Q92913
Chromosome Location : Xq26.3
Pathway : MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; Melanoma, organism-specific biosystem; Melanoma, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function : growth factor activity; protein kinase activator activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy