"FOXP1" Related Products

Expand
Expand
Expand

Recombinant Human FOXP1, His-tagged

Cat.No.: FOXP1-28111TH
Product Overview: Recombinant fragment, corresponding to amino acids 80-427 of Human FOXP1 with N terminal His tag; Predicted MWt 40 kDa.
Description: This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 162 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQ VLSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQ LLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQH LLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWK EVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNP HASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWP GCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQ QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVS SVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTT
Sequence Similarities: Contains 1 C2H2-type zinc finger.Contains 1 fork-head DNA-binding domain.
Gene Name: FOXP1 forkhead box P1 [ Homo sapiens ]
Official Symbol: FOXP1
Synonyms: FOXP1; forkhead box P1; forkhead box protein P1; 12CC4; fork head related protein like B; glutamine rich factor 1; hFKH1B; HSPC215; PAX5/FOXP1 fusion protein; QRF1;
Gene ID: 27086
mRNA Refseq: NM_001012505
Protein Refseq: NP_001012523
MIM: 605515
Uniprot ID: Q9H334
Chromosome Location: 3p14.1
Function: DNA bending activity; chromatin binding; double-stranded DNA binding; metal ion binding; protein heterodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.