"FOXP1" Related Products

Expand
Expand
Expand

Recombinant Human FOXP1 protein, GST-tagged

Cat.: FOXP1-12H
Cat.No.: FOXP1-12H
Product Overview: Recombinant Human FOXP1(1 a.a. - 114 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 38.28 kDa
AA Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: FOXP1 forkhead box P1 [ Homo sapiens ]
Official Symbol: FOXP1
Synonyms: FOXP1; forkhead box P1; forkhead box protein P1; 12CC4; fork head related protein like B; glutamine rich factor 1; hFKH1B; HSPC215; PAX5/FOXP1 fusion protein; QRF1; glutamine-rich factor 1; fork head-related protein like B; FLJ23741; MGC12942; MGC88572; MGC99551;
Gene ID: 27086
mRNA Refseq: NM_001012505
Protein Refseq: NP_001012523
MIM: 605515
UniProt ID: Q9H334
Chromosome Location: 3p14.1
Function: DNA binding, bending; chromatin binding; double-stranded DNA binding; metal ion binding; protein heterodimerization activity; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription factor binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.