Recombinant Human FOXP1 protein, GST-tagged
Cat.No. : | FOXP1-12H |
Product Overview : | Recombinant Human FOXP1(1 a.a. - 114 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-114 a.a. |
Description : | This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 38.28 kDa |
AA Sequence : | MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | FOXP1 forkhead box P1 [ Homo sapiens ] |
Official Symbol | FOXP1 |
Synonyms | FOXP1; forkhead box P1; forkhead box protein P1; 12CC4; fork head related protein like B; glutamine rich factor 1; hFKH1B; HSPC215; PAX5/FOXP1 fusion protein; QRF1; glutamine-rich factor 1; fork head-related protein like B; FLJ23741; MGC12942; MGC88572; MGC99551; |
Gene ID | 27086 |
mRNA Refseq | NM_001012505 |
Protein Refseq | NP_001012523 |
MIM | 605515 |
UniProt ID | Q9H334 |
Chromosome Location | 3p14.1 |
Function | DNA binding, bending; chromatin binding; double-stranded DNA binding; metal ion binding; protein heterodimerization activity; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; transcription factor binding; zinc ion binding; |
◆ Recombinant Proteins | ||
FOXP1-3337M | Recombinant Mouse FOXP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXP1-6010M | Recombinant Mouse FOXP1 Protein | +Inquiry |
FOXP1-1744R | Recombinant Rhesus monkey FOXP1 Protein, His-tagged | +Inquiry |
FOXP1-2447H | Recombinant Human FOXP1 protein, His-tagged | +Inquiry |
FOXP1-16H | Recombinant Human FOXP1 protein, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXP1-6146HCL | Recombinant Human FOXP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXP1 Products
Required fields are marked with *
My Review for All FOXP1 Products
Required fields are marked with *