Recombinant Human FXYD3

• Cat.No.: FXYD3-26269TH
• Product Overview: Recombinant full length Human FXDY3 with N terminal proprietary tag; Predicted MWt 33.48 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 67 amino acids
• Description: This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
• Molecular Weight: 33.480kDa inclusive of tags
• Tissue specificity: Expressed in a subset of human breast tumors.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
• Sequence Similarities: Belongs to the FXYD family.

Gene Information

• Gene Name: FXYD3 FXYD domain containing ion transport regulator 3 [ Homo sapiens ]
• Official Symbol: FXYD3
• Synonyms: FXYD3; FXYD domain containing ion transport regulator 3; FXYD domain containing ion transport regulator 3 , PLML; FXYD domain-containing ion transport regulator 3; MAT 8
• Gene ID: 5349
• mRNA Refseq: NM_001136007
• Protein Refseq: NP_001129479
• MIM: 604996
• Uniprot ID: Q14802
• Chromosome Location: 19q13.11-q13.12
• Function: ATPase binding; chloride channel activity; ion channel activity