"FXYD3" Related Products

Expand

Recombinant Human FXYD3

Cat.No.: FXYD3-26269TH
Product Overview: Recombinant full length Human FXDY3 with N terminal proprietary tag; Predicted MWt 33.48 kDa.
Description: This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protein length: 67 amino acids
Molecular Weight: 33.480kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in a subset of human breast tumors.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
Sequence Similarities: Belongs to the FXYD family.
Gene Name: FXYD3 FXYD domain containing ion transport regulator 3 [ Homo sapiens ]
Official Symbol: FXYD3
Synonyms: FXYD3; FXYD domain containing ion transport regulator 3; FXYD domain containing ion transport regulator 3 , PLML; FXYD domain-containing ion transport regulator 3; MAT 8;
Gene ID: 5349
mRNA Refseq: NM_001136007
Protein Refseq: NP_001129479
MIM: 604996
Uniprot ID: Q14802
Chromosome Location: 19q13.11-q13.12
Function: ATPase binding; chloride channel activity; ion channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.