"FZD2" Related Products

Expand
Expand
Expand

Recombinant Human FZD2

Cat.No.: FZD2-26287TH
Product Overview: Recombinant fragment corresponding to amino acids 192-245 of Human Frizzled 2 with an N terminal proprietary tag; predicted mwt: 31.57 kDa inclusive of tag.
Description: This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. This gene encodes a protein that is coupled to the beta-catenin canonical signaling pathway. Competition between the wingless-type MMTV integration site family, member 3A and wingless-type MMTV integration site family, member 5A gene products for binding of this protein is thought to regulate the beta-catenin-dependent and -independent pathways.
Protein length: 54 amino acids
Molecular Weight: 31.570kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed. In the adult, mainly found in heart, placenta, skeletal muscle, lung, kidney, pancreas, prostate, testis, ovary and colon. In the fetus, expressed in brain, lung and kidney. Low levels in fetal liver.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
Sequence Similarities: Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain.
Gene Name: FZD2 frizzled family receptor 2 [ Homo sapiens ]
Official Symbol: FZD2
Synonyms: FZD2; frizzled family receptor 2; frizzled (Drosophila) homolog 2 , frizzled 2, seven transmembrane spanning receptor , frizzled homolog 2 (Drosophila); frizzled-2;
Gene ID: 2535
mRNA Refseq: NM_001466
Protein Refseq: NP_001457
MIM: 600667
Uniprot ID: Q14332
Chromosome Location: 17q21.1
Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem;
Function: G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; protein heterodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.