Recombinant Human FZD2 protein, His-tagged
| Cat.No. : | FZD2-2612H |
| Product Overview : | Recombinant Human FZD2 protein(138-217 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 138-217 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | CEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLG |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FZD2 frizzled family receptor 2 [ Homo sapiens ] |
| Official Symbol | FZD2 |
| Synonyms | FZD2; frizzled family receptor 2; frizzled (Drosophila) homolog 2 , frizzled 2, seven transmembrane spanning receptor , frizzled homolog 2 (Drosophila); frizzled-2; frizzled homolog 2; frizzled 2, seven transmembrane spanning receptor; Fz2; fz-2; fzE2; hFz2; |
| Gene ID | 2535 |
| mRNA Refseq | NM_001466 |
| Protein Refseq | NP_001457 |
| MIM | 600667 |
| UniProt ID | Q14332 |
| ◆ Recombinant Proteins | ||
| Fzd2-380M | Recombinant Mouse Fzd2 Protein, Fc-tagged | +Inquiry |
| RFL1807XF | Recombinant Full Length Xenopus Laevis Frizzled-2(Fzd2) Protein, His-Tagged | +Inquiry |
| FZD2-1437H | Recombinant Human FZD2 protein, Fc-tagged | +Inquiry |
| RFL12571GF | Recombinant Full Length Chicken Frizzled-2(Fzd2) Protein, His-Tagged | +Inquiry |
| FZD2-4591H | Recombinant Human FZD2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD2 Products
Required fields are marked with *
My Review for All FZD2 Products
Required fields are marked with *
